PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0100s0056.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-PHD
Protein Properties Length: 663aa    MW: 72908.5 Da    PI: 5.2926
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0100s0056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.31.7e-104915341053
                           HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
              Homeobox  10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                           + +e+L ++ +k++ p+++++eeL+++lgL+ +qV  WF+N+R 
  Sphfalx0100s0056.1.p 491 SAVEALRQVLAKDQLPTKSRKEELSEQLGLSYCQVHSWFKNQRH 534
                           56889999999*******************************96 PP

2PHD41.82.5e-14167222151
                           SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                   PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                           +C+ C++  +  +++++lCdg C++ fH++Cl+++l +e++p g   wlC+ C++k
  Sphfalx0100s0056.1.p 167 FCAKCKSqeAVPDNDIILCDGaCNRGFHQYCLNPPLATEDIPPGdeGWLCPVCECK 222
                           699***966666********66********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.66E-14159226IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.4E-12162222IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001611.003165222IPR019787Zinc finger, PHD-finger
CDDcd155044.99E-33167219No hitNo description
PfamPF006281.2E-11167222IPR019787Zinc finger, PHD-finger
SMARTSM002496.4E-10167220IPR001965Zinc finger, PHD-type
PROSITE patternPS013590168219IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.602.0E-12464535IPR009057Homeodomain-like
PROSITE profilePS5007113.232479539IPR001356Homeobox domain
SMARTSM003892.6E-12481543IPR001356Homeobox domain
CDDcd000861.36E-11482539No hitNo description
SuperFamilySSF466891.2E-11482542IPR009057Homeodomain-like
PfamPF000465.7E-8491534IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MADATAAAPL KTTLRSKNPK LSPLSLPQAD VGGGSGGMTM IQANNNAPES HKTGGRRQRR  60
RRRRRQKTKE LQPLDNLTRI KRRVKYLLIK MRVEQNLIDA YSGEGWKGQS REKIRPEQEL  120
QRAESQVLHS KLAIREAIHE LDKLGFEGSL KDSAFDAEGC IYHEEIFCAK CKSQEAVPDN  180
DIILCDGACN RGFHQYCLNP PLATEDIPPG DEGWLCPVCE CKMECIEVIN AYMSTTFEVE  240
NSWEEFFAEA AAIAAGNGPG NGGGDWPSTD SEDDDYDPEG LEERPNSESE KEGKEEDSSS  300
SSDSESESGQ KVGFSNSSSD DASGKFKTPS IGKSNWDHTN SVQADSVDAG RSLDSSADEG  360
SESPLVDRGR GSRAVSDDEG PMIVAGKRQH KAVDYKKLHD EMFGNTELNE DFVSEDEDWG  420
PKRRRRRTNA DTSGKPGVGR SRALASNIST SKEGPSHENQ PDVQKAPTGD GAAIVSRQDA  480
ERKIWRRLPD SAVEALRQVL AKDQLPTKSR KEELSEQLGL SYCQVHSWFK NQRHQALRKG  540
LVTPRSQVSK TANAMIEAQV STSDGPVFNE AHTAGNEQKP RTKNTLSEKL DEVQSRLLEL  600
KRTLEDFARS MAVEDVKDVP GEGVPKFEDR SVEPSANGKR VVYVPVAEVR ERPSAATSTG  660
AY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15560RRQRRR
25562RRQRRRRR
35563RRQRRRRRR
45663RQRRRRRR
55664RQRRRRRRR
65763QRRRRRR
75864RRRRRRR
8421426KRRRRR
9422427RRRRRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001762535.10.0predicted protein
TrEMBLA9S7Y20.0A9S7Y2_PHYPA; Predicted protein
STRINGPP1S55_45V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.29e-72pathogenesis related homeodomain protein A